PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna02271.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GRAS
Protein Properties Length: 650aa    MW: 73413.4 Da    PI: 7.1438
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna02271.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS266.21.1e-812846472374
                     GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfse 86 
                               +lLl++Ae v  +++e+a++lL + + +as +g+ +q+++ yf+eAL++r+    +++y++   +e s++     +  a+ + ++
  mrna02271.1-v1.0-hybrid 284 AHLLLAAAEKVGYQQFERASRLLLQCEGIASFKGTLVQKVVCYFAEALRERIDM-ETGMYSSKGNQEMSHYVqGLGSNLAYIACHQ 368
                              69**************************************************97.8888888766666654446666667777888 PP

                     GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAee 171
                                P++ + +++a qa+ eav++e+r+H+iD++i  G+QW  +++aLa+R++ p   l iT+vg      k++++etg+rLa++A++
  mrna02271.1-v1.0-hybrid 369 EVPFHPVLQFAAIQAMIEAVANESRIHVIDLEIRFGVQWTGFIKALAERKKCPVeLLSITAVGV---RGKQNIKETGKRLASLAKS 451
                              89***********************************************97665499******9...589**************** PP

                     GRAS 172 lgvpfefnvlvakrledleleeL.rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFler 256
                              l++pf+f+ +++++++d++ + + ++k +Eal+V  ++ l ++  ++ +le+    +++++++++P ++vv+e ea+hns+sF++r
  mrna02271.1-v1.0-hybrid 452 LNLPFKFKEVIVSDMKDINGHFFnEIKDDEALVVYASFVLRTMIPRPRCLEN----LMRVMRNINPSLMVVIEVEANHNSPSFVNR 533
                              *******************999956778****************99999999....****************************** PP

                     GRAS 257 flealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllr 342
                              f++al yysa+fd+le+ + ++++ r+ +E   l++ i+n+va+eg+er+ r  +l  Wr+ + ++G+ + ++s++   qa+l+ +
  mrna02271.1-v1.0-hybrid 534 FIDALFYYSAFFDCLENCM-KHNKYRVIMEDL-LRKGIRNIVAAEGRERVVRSVKLDVWRAFFAKFGMVETSFSNSSLYQASLVAK 617
                              ***************9996.777888888877.***************************************************** PP

                     GRAS 343 kvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              kv     +++ + + l+ gWk+ p+ s+SaW+
  mrna02271.1-v1.0-hybrid 618 KVCC--TTLDRNGKGLTVGWKGTPIHSLSAWE 647
                              *994..5999999******************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE patternPS000180228240IPR018247EF-Hand 1, calcium-binding site
PROSITE profilePS5098539.987257629IPR005202Transcription factor GRAS
PfamPF035143.9E-79284647IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MANAFFSSTP LDFGIPGGLS PPQLEEYDKE DTVMFNVGKG NHLFGLDDDQ LGEMNTLSSE  60
HGFYQDNKAK KGGVVSYLSK DQNQHHDLDH QQQQQQSKPN FLILDNFNFE TVSSQHGFYH  120
GSMAGMNDQQ QQQQVKLSSS CLENYSSFNF SFQSGQVTQP VKDGAQFRQN HCSDIVEANK  180
QLPPPQSSIA TLELLKSYGS AFKMLKRERQ SSSRTTRGNE IDQNNNYDVN GTQKLSTEEV  240
MRVAGARYVQ FSSQGYEDFY MPMHHFGYAL SGLCEEETKD VEIAHLLLAA AEKVGYQQFE  300
RASRLLLQCE GIASFKGTLV QKVVCYFAEA LRERIDMETG MYSSKGNQEM SHYVQGLGSN  360
LAYIACHQEV PFHPVLQFAA IQAMIEAVAN ESRIHVIDLE IRFGVQWTGF IKALAERKKC  420
PVELLSITAV GVRGKQNIKE TGKRLASLAK SLNLPFKFKE VIVSDMKDIN GHFFNEIKDD  480
EALVVYASFV LRTMIPRPRC LENLMRVMRN INPSLMVVIE VEANHNSPSF VNRFIDALFY  540
YSAFFDCLEN CMKHNKYRVI MEDLLRKGIR NIVAAEGRER VVRSVKLDVW RAFFAKFGMV  600
ETSFSNSSLY QASLVAKKVC CTTLDRNGKG LTVGWKGTPI HSLSAWEFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2428964614374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301794.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5VUD50.0M5VUD5_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.15e-51RGA-like 1